SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6E434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6E434
Domain Number 1 Region: 406-468
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000164
Family DNA-binding domain of telomeric protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6E434
Sequence length 485
Comment (sp|Q6E434|TRF1_SCHPO) Telomeric DNA-binding factor trf1 KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=trf1; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSKRSLDPSDDFKGQKRLAIDPESTALEQDRQMLQQLSEQNSELEPQNVAPNAEIPLGFD
LSGIQFNMTPDFYLRMNQGMDYAFNQPNPIATPQQLLRTSLIPTLGNLSNIILSILGKPV
QEASAIVTNPASEMGMAFTKVMNMFRMVKDIYTEESFIYSSAIGMRTPSQRSTTRRANLA
IFLAAVYGALQIGFFHLNENFLEVFAPDESNILTNQGTLYMELKTQAYISAMAQAERPKG
DILNDLFPSDMAHRFLIRRNAKLDDKLTYVEKQIIEKCTARKERLANFSPQEALNEVYPW
GKFLSEIACYIHNNYSSISAIPIPANSFKRRSKKNGLRFKAGEAESSPSESGSDLTDSLA
FGIPSSTFDGSSETQNVSSVVLYDQVRHMTNNNLNNKRTRRVANRRSWTKEEEEALLDGL
DLVKGPRWSQILELYGPGGKKSEVLKYRNQVQLKDKARNMKLFFLKSGQVVPAALQCVTG
DLRRD
Download sequence
Identical sequences Q6E434
4896.SPBC19G7.13-1 NP_595979.1.19918 SPBC19G7_13.1 SPBC19G7.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]