SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6EJB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6EJB7
Domain Number 1 Region: 25-107
Classification Level Classification E-value
Superfamily HMG-box 2.75e-29
Family HMG-box 0.00000908
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6EJB7
Sequence length 300
Comment (sp|Q6EJB7|SOX3_DANRE) Transcription factor Sox-3 KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=sox3 OC=Cyprinidae; Danio.
Sequence
MYNMMETEIKSPIPQSNTGSVTGGKNNSANDQDRVKRPMNAFMVWSRGQRRKMAQENPKM
HNSEISKRLGADWKLLTDAEKRPFIDEAKRLRAMHMKEHPDYKYRPRRKTKTLLKKDKYS
LPGGLLAPGANAVNNAVSVGQRMDYTHMNGWTNSAYSLMQDQLAYPQHPSMNSPQIQQMH
RYDMAGLQYPMMSTAQTYMNAASTYSSMSPAYTQQTSSAMGLGSMASVCKTEPSSPPPAI
TSHSQRACLGDLRDMISMYLPPGGDSADHSSLQTSRLHSVHPHYQSAGTGVNGTLPLTHI
Download sequence
Identical sequences A9JSZ3 Q6EJB7
NP_001001811.2.45394 ENSDARP00000070099 7955.ENSDARP00000070099 ENSDARP00000070099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]