SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6EWH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6EWH2
Domain Number 1 Region: 258-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.6e-84
Family Protein kinases, catalytic subunit 0.000000000518
Further Details:      
 
Domain Number 2 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-40
Family SH2 domain 0.00000264
Further Details:      
 
Domain Number 3 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-27
Family SH3-domain 0.0000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6EWH2
Sequence length 537
Comment (sp|Q6EWH2|FYNA_DANRE) Proto-oncogene c-Fyna KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=fyna; OC=Cyprinidae; Danio.
Sequence
MGCVQCKDKEATKLTDERETSVSQHAGYRYGSDPTPQHYPSFGVTAIPNYNNFHAPVSQG
VTVFGGVNSSSHSGTLRSRGGTGVTLFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWW
EARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESET
TKGAYSLSIQDWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCC
RLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKT
LKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
GLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGDNL
Download sequence
Identical sequences Q6EWH2
ENSDARP00000123888 ENSDARP00000123888 NP_001315092.1.45394 7955.ENSDARP00000003208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]