SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6GMG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6GMG3
Domain Number 1 Region: 310-572
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-67
Family Nuclear receptor ligand-binding domain 0.00000000782
Further Details:      
 
Domain Number 2 Region: 238-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-27
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6GMG3
Sequence length 574
Comment (tr|Q6GMG3|Q6GMG3_DANRE) Nuclear receptor subfamily 4, group A, member 1 {ECO:0000313|EMBL:AAH74092.1, ECO:0000313|Ensembl:ENSDARP00000001911} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nr4a1 OC=Cyprinidae; Danio.
Sequence
MTCVQSQHGVQSYESSLFSSEFLNPDFTSRLAMDVTEQREQLSAPSLPSITSLVGGYVGE
FDTYSCQIATGAASTCVGSTSGQLDSFKLDDLQVYGCYPGTFALSYLDETLSSSGGSNCF
GSPASAPSPSTPGYQHMSAWDSTFGPCSPDEGCWGSEKPLNQAASFFTFGHVTADELSPL
GQMQSQIPDQDPFSHTPQHGSPLPFSPLSLEQGSRDGSGLMDGHLSPKVRSPTGNEGRCA
VCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKDCPVDKRRRNRCQFCRFQKCL
AVGMVKEVVRTDSLKGRRGRLPSKPKAVQDSVSVSSPVNIIASLVTAHIDSNPASANLDY
SKYQESTSGLPEKEDANDIQQFYDLLTGSMDVIRKWAGSIPGFSAFCKEDQELLLESAFV
ELFILRLAYRSNPETDKLIFCNGVVLHRTQCVRSFGDWIDSIMEFSQSLHRLNLDISAFS
CLATLVIITDRHGLKEPKRIEDFQNRLITCLRDHVSTSALEVGRPNSLSRLLSKLPELRT
LCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences Q6GMG3
ENSDARP00000001911 NP_001002173.1.45394 ENSDARP00000001911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]