SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6GP73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6GP73
Domain Number 1 Region: 91-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.000000852
Further Details:      
 
Domain Number 2 Region: 19-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.45e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6GP73
Sequence length 240
Comment (tr|Q6GP73|Q6GP73_XENLA) Chloride intracellular channel protein {ECO:0000256|RuleBase:RU362009} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18039212mg OC=Xenopus.
Sequence
MSEQPQVELFVKAANDGQSIGNCPFSQRLFMVLWLKGVTFNVTTVDMKKKPDILKDLAPG
AQPPFLLFAGEVRTDTNKIEEFLEETLCPPKYPKLACRNPESNNAGVNVFAKFSAYIKNP
NPALNQNLVNGLLKALNVLDRYLNTPLPDEIDENCAEDETVSNRKFLDGNELTLADCNLL
PKLNIVQVVCEHFRGFKIPAEFTGIHRYLQNAYKREEFASTCPDAAEISRAYAEVAKPLK
Download sequence
Identical sequences Q6GP73
NP_001085738.1.7800 gi|148224186|ref|NP_001085738| gi|49118259|gb|AAH73268|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]