SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6H9L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6H9L7
Domain Number 1 Region: 329-365
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6H9L7
Sequence length 571
Comment (sp|Q6H9L7|ISM2_HUMAN) Thrombospondin type-1 domain-containing protein 3 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ISM2; OC=Catarrhini; Hominidae; Homo.
Sequence
MRALRDRAGLLLCVLLLAALLEAALGLPVKKPRLRGPRPGSLTRLAEVSASPDPRPLKEE
EEAPLLPRTHLQAEPHQHGCWTVTEPAAMTPGNATPPRTPEVTPLRLELQKLPGLANTTL
STPNPDTQASASPDPRPLREEEEARLLPRTHLQAELHQHGCWTVTEPAALTPGNATPPRT
QEVTPLLLELQKLPELVHATLSTPNPDNQVTIKVVEDPQAEVSIDLLAEPSNPPPQDTLS
WLPALWSFLWGDYKGEEKDRAPGEKGEEKEEDEDYPSEDIEGEDQEDKEEDEEEQALWFN
GTTDNWDQGWLAPGDWVFKDSVSYDYEPQKEWSPWSPCSGNCSTGKQQRTRPCGYGCTAT
ETRTCDLPSCPGTEDKDTLGLPSEEWKLLARNATDMHDQDVDSCEKWLNCKSDFLIKYLS
QMLRDLPSCPCAYPLEAMDSPVSLQDEHQGRSFRWRDASGPRERLDIYQPTARFCLRSML
SGESSTLAAQHCCYDEDSRLLTRGKGAGMPNLISTDFSPKLHFKFDTTPWILCKGDWSRL
HAVLPPNNGRACTDNPLEEEYLAQLQEAKEY
Download sequence
Identical sequences Q6H9L7
ENSP00000216481 9606.ENSP00000341490 gi|40805858|ref|NP_954993.1| ENSP00000341490 NP_954993.1.87134 NP_954993.1.92137 ENSP00000341490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]