SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6J6X9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6J6X9
Domain Number 1 Region: 24-128
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 2.22e-34
Family Chemosensory protein Csp2 0.0000935
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6J6X9
Sequence length 129
Comment (tr|Q6J6X9|Q6J6X9_SCHGR) Antennal CSPSgre-III-1 {ECO:0000313|EMBL:AAT39531.1} OX=7010 OS=Schistocerca gregaria (Desert locust). GN=CSP57 OC=Schistocerca.
Sequence
MAGKLVLCCLLGLFVLCIEAAPQDKLDSFNVDEVLNNERLLKSYIQCMLDADEGRCTNEG
KEIKKRLPKFVANGCLDCTPSQLERAIKTLRHVTEKYPEEWTKLKAKFDPTGEYAKKHAE
TWKQRGITF
Download sequence
Identical sequences Q6J6X9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]