SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6K953 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6K953
Domain Number 1 Region: 30-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.5e-34
Family Thioltransferase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6K953
Sequence length 133
Comment (sp|Q6K953|GRXC4_ORYSJ) Glutaredoxin-C2 homolog 2 KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OJ1014_H03.21, OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGMAQSSSSSSRPSDSEQLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLA
ELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVP
LLTEAGAIATPSL
Download sequence
Identical sequences A0A0E0IKH4 A0A0E0NHU5 I1P291 Q6K953
LOC_Os02g40500.1|13102.m04514|protein ORGLA02G0209700.1 OsIBCD007238 ONIVA09G12430.1 XP_015626005.1.37577 39946.BGIOSIBCE007836 39947.LOC_Os02g40500.1 LOC_Os02g40500.1|PACid:21920399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]