SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6LC96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6LC96
Domain Number 1 Region: 178-435
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.34e-83
Family Nuclear receptor ligand-binding domain 0.000000000841
Further Details:      
 
Domain Number 2 Region: 109-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-31
Family Nuclear receptor 0.00000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6LC96
Sequence length 439
Comment (tr|Q6LC96|Q6LC96_MOUSE) Retinoic acid receptor RXR-alpha {ECO:0000313|Ensembl:ENSMUSP00000097822} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=RXR OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQAT
Download sequence
Identical sequences Q6LC96
ENSMUSP00000097822 ENSMUSP00000109567 NP_001277410.1.92730 NP_001277411.1.92730 XP_006497868.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]