SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6M9R9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6M9R9
Domain Number 1 Region: 384-642
Classification Level Classification E-value
Superfamily RNI-like 1.77e-52
Family 28-residue LRR 0.051
Further Details:      
 
Domain Number 2 Region: 193-467
Classification Level Classification E-value
Superfamily RNI-like 7.06e-43
Family 28-residue LRR 0.052
Further Details:      
 
Domain Number 3 Region: 84-157
Classification Level Classification E-value
Superfamily POZ domain 0.00000118
Family BTB/POZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6M9R9
Sequence length 659
Comment (tr|Q6M9R9|Q6M9R9_PARUW) Uncharacterized protein {ECO:0000313|EMBL:CAF24680.1} KW=Complete proteome; Reference proteome OX=264201 OS=Protochlamydia amoebophila (strain UWE25). GN=pc1956 OC=Candidatus Protochlamydia.
Sequence
MNISNSRFRHSYLVNTTTLSYSQSQEINDPLVDENNPLDNPLANIEETSESTIPASDLSS
SPEEVQLSFQEGTSLTISHSQLVLLRDKSHYFNNLWSGQFQETLQHPLALTQKEFTLLLN
CLMNPKFEIPLEEITSVIQLADYYEVTEVVKHLEGQLIIGYKSQRFEPFNSTEESLVELK
ELLNFAHRCQLNTLKNYLEFSVTSALLNQTSQLTEFQRIINQFSNEIEALNFSENAHLTD
AHLLALKNCKNLKELHLQECRNLTDAGLVHLAPLVALKHLNLNFCDKLTNTGLAHLRPLT
ALQHLNLGNCRNLTDAGLAHLTPLTALQHLNLNFCDKLTDTGLVRLSPLTALQHLDLSDC
ENLTDAGLVHLKPLVALQHLNLSCCENLTDAGLVHLKLLVALQHLDLSDCNNLTDAGLAH
LTPLTALQYLDLSYCNNLTDAGLVHLKFLTALQHLDLRGCDKVADDGLAHLTPLTALQAL
SLSQCRNLTDAGLGHLKLLTALQYLRLSQCWNLTDAGLIHLRPLVALQHLDLSYCGNLTD
VGLVHLTPLMALQHLDLNYCENLTGDGLAHLRSLTTLQHLSLNQCWNLTDAGLVHLEPLT
ALQHLDLSYCGNFTDVGLVHLTSLMALQHLNLRGCDRVTDVGLALFKIFATSLHLKIIK
Download sequence
Identical sequences Q6M9R9
WP_011176501.1.90613 264201.pc1956 gi|46447590|ref|YP_008955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]