SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6NW58 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6NW58
Domain Number 1 Region: 292-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-57
Family Extended AAA-ATPase domain 0.0000268
Further Details:      
 
Weak hits

Sequence:  Q6NW58
Domain Number - Region: 82-142
Classification Level Classification E-value
Superfamily MIT domain 0.000235
Family MIT domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6NW58
Sequence length 570
Comment (sp|Q6NW58|SPAST_DANRE) Spastin {ECO:0000255|HAMAP-Rule:MF_03021} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:ch73-233a22.3, OC=Cyprinidae; Danio.
Sequence
MNSGHKARLRGGRACGPVSDGSARGNRLLFYTRSLSRVPEWLLRVLLLLLRWLFQPIRRA
MAARAKECGPDGSEETGERIRNYHKQAFEFISVALQIDEDEKGDKQKAVQWYRKGIAELE
KGIQIQVTGAGEKADRARKLQDKMITNLSMAEDRLKLLGNLLSQSPAESSSDDSFYSFSN
GNLRPAPASGAVSKKKDTLTITNQTSLRPKNPPKSTPNASGLNCTPSAAQSSRTGPQNNQ
KGPTVKGKNNVKASTTATASPQRKRDMKNFKNVDSKLASLILNEIVDSGSVVRFDDIAGQ
DLAKQALQEIVILPALRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNIS
AATLTSKYVGEGEKLVRALFAVARELQPSIIFIDEIDSLLCERREGEHDASRRLKTEFLI
EFDGVQSGGDERVLVMGATNRPQELDEAVLRRFAKRIYVALPTEETRLKLLKNLLSKHRN
PLSQKELSQLARLTDGYSGSDLTSLAKDAALGPIRELKPEQVRNMSAHEMRDIRISDFLE
SLKRIKRSVSPQTLDQYVRWNREYGDTTGV
Download sequence
Identical sequences Q6NW58
ENSDARP00000029675 NP_998080.2.45394 ENSDARP00000029675 7955.ENSDARP00000029675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]