SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6NZL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6NZL8
Domain Number 1 Region: 832-940
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-24
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 312-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 32-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.08e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 674-829
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000124
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.016
Further Details:      
 
Domain Number 6 Region: 206-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000628
Family EGF-type module 0.028
Further Details:      
 
Domain Number 7 Region: 165-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6NZL8
Sequence length 1018
Comment (sp|Q6NZL8|SCUB1_MOUSE) Signal peptide, CUB and EGF-like domain-containing protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Scube1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGAAAVRWHLYLLLALGARGRLVGGSGLPGAVDVDECSEGTDDCHIDAICQNTPKSYKCL
CKPGYKGEGRQCEDIDECENDYYNGGCVHDCINIPGNYRCTCFDGFMLAHDGHNCLDVDE
CQDNNGGCQQICVNAMGSYECQCHSGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRET
PKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHADGRT
CIEKDEAAIERSQFNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVG
FTLQPDGKTCKDINECLMNNGGCDHFCRNTVGSFECGCQKGHKLLTDERTCQDIDECSFE
RTCDHICINSPGSFQCLCRRGYTLYGTTHCGDVDECSMNNGSCEQGCVNTKGSYECVCPP
GRRLHWNQKDCVEMNGCLSRSKASAQAQLSCGKVGGVENCFLSCLGHSLFMPDSESSYIL
SCGVPGLQGKTLPKRNGTSSSTGPGCSDAPTTPIRQKARFKIRDAKCHLQPRSQERAKDT
LRHPLLDNCHVTFVTLKCDSSKKRRRGRKSPSKEVSHITAEFEVEMKVDEASGTCEADCM
RKRAEQSLQAAIKILRKSIGRNQFYVQVLGTEYEVAQRPAKALEGTGTCGIGQILQDGKC
VPCAPGTYFSGDPGQCMPCVSGTYQDMEGQLSCTPCPSSEGLGLAGARNVSECGGQCSPG
YFSADGFKPCQACPVGTYQPEPGRTGCFPCGGGLLTKHTGTASFQDCEAKVHCSPGHHYN
TTTHRCIRCPVGTYQPEFGQNHCISCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIE
SPNYPGDYPANAECVWHIAPPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSVTTYE
TCQTYERPIAFTSRSRKLWIQFKSNEANSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYAS
ENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences Q6NZL8
ENSMUSP00000016907 ENSMUSP00000016907 10090.ENSMUSP00000016907 NP_001258401.1.92730 ENSMUSP00000075434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]