SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6P1V9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P1V9
Domain Number 1 Region: 315-474
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000115
Further Details:      
 
Domain Number 2 Region: 150-306
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000404
Further Details:      
 
Domain Number 3 Region: 68-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000194
Family EGF-type module 0.009
Further Details:      
 
Domain Number 4 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000295
Family EGF-type module 0.014
Further Details:      
 
Domain Number 5 Region: 28-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000794
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6P1V9
Sequence length 475
Comment (tr|Q6P1V9|Q6P1V9_XENTR) Milk fat globule-EGF factor 8 protein {ECO:0000313|EMBL:AAH64852.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=mfge8 OC=Silurana.
Sequence
MDGSVRALHTLVTFTLLTSGLVLAVPGELCGKTPCLNGGTCLKDAPDNPFCLCPVGFTGI
DCNITEKGPCDPNPCQNSGECQVLSDSGRGDTFVQYFCKCLPGYEGHNCEINKNHCYTNP
CKNGGICKHLGDDFSCKCASPYIGKVCNIRCANALGMEGRAISDAQITSSSMYHGFLGLQ
RWGPNLARLNNKGMVNAWTANSLDQHPWIQVNLLREMRVSGVITQGASRMGTAEYVKEFK
VAYSVDGHEFTFYKSEGKDKLFPGNIDNDGRKANLFSPPISARFIRIYPVTCRVACTLRF
ELYGCEPSVYFNMVGCSDPLGMKTQVISDKQIKASSVYKTWGIDAFTWHPHYARLDKIGK
TNAWTALENNQEQWLQIDLRIPKKISGIITQGAKDFGNIQYVESFKVAYSDDGNTWKIYK
DSRTKADKIFLGNNDNYSHKKNLFDVPFSARFVRVLPQSWHERITLRMELLGCDD
Download sequence
Identical sequences Q6P1V9
gi|40674508|gb|AAH64852| gi|45361655|ref|NP_989401| NP_989401.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]