SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6P2X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P2X6
Domain Number 1 Region: 151-297
Classification Level Classification E-value
Superfamily EF-hand 6.7e-51
Family Osteonectin 0.000000185
Further Details:      
 
Domain Number 2 Region: 92-147
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000513
Family Ovomucoid domain III-like 0.0000893
Further Details:      
 
Domain Number 3 Region: 67-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000768
Family Follistatin (FS) module N-terminal domain, FS-N 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6P2X6
Sequence length 300
Comment (tr|Q6P2X6|Q6P2X6_XENTR) Secreted protein, acidic, cysteine-rich (Osteonectin) {ECO:0000313|EMBL:AAH64259.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=sparc OC=Silurana.
Sequence
MRVWVFFVLCLVGKALAAPQQDALPEEEEVIEDVPTEETVGANPVQVEVGEFDDAVNEEE
EEEPSENPCLNHHCKHGKVCEVDESNTPMCVCQDPSTCPSSLAEFEKVCGTDNKTYESSC
HFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDNELSEFPLRMRDWLKNVLVSLYERDE
NNNLLNEKQKLRVKKIHENEKRLEAGDHSMELLARDFEKNYNMYIFPVHWQFGQLDQHPI
DGYLSHTELSPLRAPLIPMEHCTTRFFDECDTDNDKYIALEEWAKCFGIKEQDVDKDMIV
Download sequence
Identical sequences Q6P2X6
gi|39850164|gb|AAH64259| gi|45361541|ref|NP_989347| gi|46562002|gb|AAT01218| gi|51261596|gb|AAH79950| NP_989347.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]