SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6P4Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P4Z4
Domain Number 1 Region: 224-295
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 284-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 344-414
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 404-463
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000136
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000101
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 171-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 70-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  Q6P4Z4
Domain Number - Region: 38-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00469
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 471-543
Classification Level Classification E-value
Superfamily Fibronectin type III 0.057
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6P4Z4
Sequence length 904
Comment (tr|Q6P4Z4|Q6P4Z4_XENTR) Uncharacterized protein {ECO:0000313|EMBL:AAH63189.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=MGC75573 OC=Silurana.
Sequence
MTTEGIVLLLVLPLCLALALPCHAQLQDDASGQDVCKKCHTNATCLERNKKYSCICNYGL
IGNGRTHCLDKDECQIGSYKICGNHTACHNTHGSFFCVCLDGYRPSNNHKHFIPNDGTFC
TDIDECESADICGYKGKCKNIPGSYECYCMDGYQLKNGTEPFQANSDNGCVDVDECEAED
ICGHNAKCRNVPGNHECYCMEGYRLNNGTEPFQAHSRMNLCSVIDCGQPPALLHSQMNLE
GNTTFGSQVTYRCDAGFTATAGRAMSICTSNGTWEGASLVCTVIDCGFPPVVPNALINSS
DNTTFGSNVTYTCMKGYVASSGYGFARCAQNGKWEAATLSCQVVDCGQPPSIQHTSSKFA
RNTTLGNTIAYECMSGYVKQSGNGIAVCNEDGEWDGADLICKEINCGLPPPVPNTQVILS
GTTNLGSEVEYKCVHGYYNPGNRSVSRCTLNEKWEEVNVTCKVIGILIGNVTVFNETCLR
WRKSSEIIDWEILYKFSILGKGWHQIHYVHEKDFKLLTNNSFQCLDLLPGNNYLVIMRAV
FPEMQEISINITLETAMIKRFGDITLFNTTCLQWTKSSGKNEELEEYTVLIKGQVWKPPK
ISLNIMFNFSTSSRNPVLCLMLPPEEEYIVNVTESSTGLSSSIPFRTLGHDSEDVSGTAP
LGENCLQWNRSIEENGVQEIYRIHVQEAQGQPKPNPQLLLFNISTDQGTSQVCFKIATDQ
QQLNMTEAPSPPEANTTRELDTPLPKVQFVSKYGQLPKVSIQKTDQHAPFSSYQVFVKHS
GPLCSFTCDSLEAVPYFHNISKTRAYVTAEFSPSDIPEVLEFSLGDRQYYGEFYNAPLAQ
EKDYCIILRIISRWDRVPECILVAEIKGFTPSRNYMNIVLPGSVAFVWFIIFLSYSAARC
CKRR
Download sequence
Identical sequences Q6P4Z4
gi|38648935|gb|AAH63189| gi|45361289|ref|NP_989222| NP_989222.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]