SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6P5Q4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6P5Q4
Domain Number 1 Region: 195-360
Classification Level Classification E-value
Superfamily RNI-like 6.12e-42
Family 28-residue LRR 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6P5Q4
Sequence length 547
Comment (sp|Q6P5Q4|LMOD2_HUMAN) Leiomodin {ECO:0000303|PubMed:18403713} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LMOD2; OC=Catarrhini; Hominidae; Homo.
Sequence
MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTP
TGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE
EEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNSDNSKPKIFKSQIENINLTNGSN
GRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNT
VVKTFSLANTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTE
LRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRL
QEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVAT
PPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKK
KGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIKQLKRV
EVPEALR
Download sequence
Identical sequences Q6P5Q4
ENSP00000398975 ENSP00000411932 9606.ENSP00000411932 NP_997046.1.87134 NP_997046.1.92137 gi|150378503|ref|NP_997046.1| ENSP00000411932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]