SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PA42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PA42
Domain Number 1 Region: 77-191
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.14e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.88e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6PA42
Sequence length 194
Comment (tr|Q6PA42|Q6PA42_XENLA) MGC68589 protein {ECO:0000313|EMBL:AAH60462.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN=MGC68589 OC=Xenopus.
Sequence
MPSYKLIYFNLEGRGEILRYLFSYSNIEFEDRRLEFADWPALKPSIPYGQLPVVEIDGVI
FNQSLAIGRYLAKKAGLIGKNDLDEIRVDAIIDTIDDFFSKFPWMDTDKAKKEFMDKSGI
QLLAYLEKTLGNNSWFVGDSVTWADFYWDTCADCFENYLPGFAKDYPKLLALQERVKAIP
AIASWIKKRPKKTQ
Download sequence
Identical sequences Q6PA42
NP_001083518.1.7800 gi|147899575|ref|NP_001083518| gi|38051840|gb|AAH60462|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]