SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PBX3
Domain Number 1 Region: 99-149
Classification Level Classification E-value
Superfamily Orange domain-like 2.75e-16
Family Hairy Orange domain 0.0025
Further Details:      
 
Domain Number 2 Region: 25-94
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6PBX3
Sequence length 270
Comment (tr|Q6PBX3|Q6PBX3_DANRE) Her6 protein {ECO:0000313|EMBL:AAH59551.1} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=her6 OC=Cyprinidae; Danio.
Sequence
MPADIMEKNSSSPVAATPASMNTTPDKPKTASEHRKSSKPIMEKRRRARINESLGQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNMQRAQMTAALNTDPTVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLASCMTQINAMNYPTQHQIPAGPPHPSFSQPMVQIPSA
TQQANVVPLSGVPCKSGSSSNLTSDATKVYGGFQLVPATDGQFAFLIPNAAFAPNGPVIP
VYANNSNTPVPVAVSPGAPSVTSDSVWRPW
Download sequence
Identical sequences Q6PBX3
NP_571154.2.45394 ENSDARP00000018393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]