SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PH45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PH45
Domain Number 1 Region: 206-504
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.19e-84
Family WD40-repeat 0.0000382
Further Details:      
 
Domain Number 2 Region: 70-123
Classification Level Classification E-value
Superfamily PRP4-like 2.48e-16
Family PRP4-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6PH45
Sequence length 507
Comment (tr|Q6PH45|Q6PH45_DANRE) PRP4 pre-mRNA-processing factor 4 homolog (yeast) {ECO:0000313|EMBL:AAH56720.1, ECO:0000313|Ensembl:ENSDARP00000088166} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=prpf4 OC=Cyprinidae; Danio.
Sequence
MSDEDEAPVVKRSRIFYGSLEEKEKERLSREGTSTTAKDAVKAGIEAGHINISSGESMEM
EERVSERQAEVLAEFERRKRARQITVSTDDVEVKACLRALGEPITLFGEGPAERRERLRN
VLSVLGPDALKKSKKEDEKAKRTHEEYQQTWYHEGPTSLKEARLWLAKYSLPRAVKRLDA
ARAQKEIPESTRTIKQQELHKNLRNVNNFCSQIGDDRPISYCQFSPNSKLLVTASWSGLC
KLWKVPDCTLIRTLRGHNTNVGAISFHPQATLTLEESDVNMASCAADGSVKLWSLDSDEP
IADIEGHSMRVARVTWHPSGRFLGTTCYDHSWRLWDLEVQEEILHQEGHSKGVHDLHFHP
DGSLAGTGGLDSFARVWDLRTGRCVMFLEGHIKEIYSINFSPNGFHVATGSGDNACKVWD
LRQRRCIYTIPAHQNLVSSVKFQPNDGHYLLTGAYDNTAKIWTHPGWSPLKTLAGHEGKV
MGVDLSPDGQLIATCSYDRTFKLWMSE
Download sequence
Identical sequences Q6PH45
ENSDARP00000088166 ENSDARP00000103157 NP_956049.1.45394 7955.ENSDARP00000088166 7955.ENSDARP00000103157 ENSDARP00000088166 ENSDARP00000103157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]