SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PHP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PHP4
Domain Number 1 Region: 60-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000425
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 708-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000026
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 477-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000262
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 4 Region: 526-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000355
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 616-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000109
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 6 Region: 771-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000029
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 570-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000414
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  Q6PHP4
Domain Number - Region: 149-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0108
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6PHP4
Sequence length 879
Comment (tr|Q6PHP4|Q6PHP4_MOUSE) Znf512b protein {ECO:0000313|EMBL:AAH56460.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_140111 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
GKGGSRKEAQLPLLQDPPKLGMPVVHSGHTVPSQAPLCFDPGNSASDKTEGKKKGRPKAE
NQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGVRGCGPGKR
RPGGASGQRPPGPHPTPALPAQGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDHPLP
APKPGPVSRPVTISRPVGVSKPIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVT
VSRPMQVSRPVPVTKPIPITKPVPLTKHMPVTKLVTVSKPVPLTKPVPVSRPIVVSKPVP
VSRPIAISRHIPPCKMVLLSKSENKTLRATGKNSNKKRAADSLDTCPILSKQARPENGAY
GPSSMDQSVTFPLSTDPSGSRPLMGKEALRPIGPVSQPEEDPERTKHRRKQKTPKKFTGE
QPSISGTFGLKGLAKAEDKARVHRSKKQEGSGSEEVRKKVLATPVTVSKEAPTPVAHPAP
GGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCHKLQEALKCQHCRKQFKSKA
GLNYHTMAEHSAKPTDAEASEGGEQEERERLRKVLKQMGRLRCPQEGCGAAFSSLMGYQY
HQRRCGKPPCEVDSPSFPCTHCGKTYRSKAGHDYHVRSEHTAPPPEDPTDKIPEAEDLLG
VERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTRPGLPTLN
PQLLEAWKNEVKEKGHVNCPNDCCEAIYASVSGLKAHLASCSKGDHLVGKYRCLLCPKEF
SSESGVKYHILKTHGENWFRTSADPSSKHKSQDSLMPRKEKKKSLSGGKKRGRKPKERSS
EEPASKLPPNRDDWPPGGRDRGSRSSTGKKAGAGKAPEK
Download sequence
Identical sequences Q6PHP4
ENSMUSP00000114378 ENSMUSP00000115601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]