SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PKY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PKY5
Domain Number 1 Region: 155-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000142
Family Arc1p N-terminal domain-like 0.09
Further Details:      
 
Weak hits

Sequence:  Q6PKY5
Domain Number - Region: 20-76
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0336
Family Glutathione S-transferase (GST), N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6PKY5
Sequence length 320
Comment (tr|Q6PKY5|Q6PKY5_XENLA) Metaxin 1 {ECO:0000313|EMBL:AAT02191.1} KW=Complete proteome; Reference proteome OX=8355 OS=Xenopus laevis (African clawed frog). GN=XELAEV_18043016mg OC=Xenopus.
Sequence
MAAPMELYCWKGDWGLPSVDPDCLTVLTYAKFSGAPLKVHKITNPWRSPSGRLPALKTSD
DGVLFQPSRIITHLRKQKYNADYDLSARQGADTLAFISLLEEKLLPALIHSFWVEGKNYV
EHTRKWYAESIPFPLNFFLPNQMHKRNMERLKLIRGESWREEDEEMEGRLYTDAHECLSL
LSQRLANNNFFFGDSPASLDAYVFSHLAPILNAKLPNNKLQQHLSSLPNLCRYCTSIITV
YFPWEQESGPRVAPKPPSAETQDTEDDPHKRRNQVLSVLAGLLAMVGYAVLSGIVSIQRV
APDHALEQGITMEDNEEEEE
Download sequence
Identical sequences Q6PKY5
gi|147904930|ref|NP_001084470| gi|46811895|gb|AAT02191| gi|49522726|gb|AAH71140| NP_001084470.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]