SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6Q413 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6Q413
Domain Number 1 Region: 207-351
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-40
Family Third domain of FERM 0.00000212
Further Details:      
 
Domain Number 2 Region: 99-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.00000194
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.05e-24
Family First domain of FERM 0.0000157
Further Details:      
 
Domain Number 4 Region: 499-586
Classification Level Classification E-value
Superfamily Moesin tail domain 2.35e-21
Family Moesin tail domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6Q413
Sequence length 586
Comment (tr|Q6Q413|Q6Q413_DANRE) Nf2a {ECO:0000313|EMBL:AAS66973.1} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=nf2 OC=Cyprinidae; Danio.
Sequence
MSILGLKKKQPKTFKVKVSTMDAEMEFSCEVKWKGKDLFDLVCRTIGLRETWFFGLRYTV
KDTYAWLKPDKRVLDQEVPKDSPITFHFLAKFFPEKVEDELVQEITQHLFFLQVKKQILD
EEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMTPDMWEEKI
TAWYAEHRNITRDEAEMEYLKIAQDLDMYGVSYFSITQNKRDTELLLGVDAQGLHIYNPN
NKLSPNKSFPWSGIRNISYSEKEFTIKPLDKKKEVFKFYSSQLRVNKLILQLCIGNHDLF
MRRRKVDSIEVQQMKAQAKEEKARKKVERQILAREKQMREEAERAKEEMERRMFQLQDEA
RMANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRLEVTALKTKEEKRLME
QKMREAEQLAVKLVEQSERRLKEADHLKQDLNEAKDAERRAKQKLLEITKTTYPLIAAYS
NPPPPAGPESPEMAIEMGNPIQMDFKDSDMKRLSMEIERERLEYMEKSKHLQDQLKELKS
EIESLKLEEQQQAGVYNLRSYAEPPFIPPSNRNSAYMAQMAFYEEV
Download sequence
Identical sequences Q6Q413
ENSDARP00000035057 7955.ENSDARP00000035057 NP_998116.1.45394 ENSDARP00000035057 ENSDARP00000112172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]