SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6RBZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6RBZ1
Domain Number 1 Region: 264-339
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 175-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.16e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 3 Region: 99-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 
Domain Number 4 Region: 456-486
Classification Level Classification E-value
Superfamily WW domain 0.00000000341
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6RBZ1
Sequence length 488
Comment (tr|Q6RBZ1|Q6RBZ1_CHLRE) Circadian RNA-binding protein CHLAMY 1 subunit C1 {ECO:0000313|EMBL:AAR90343.1} OX=3055 OS=Chlamydomonas reinhardtii (Chlamydomonas smithii). GN= OC=Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas.
Sequence
GNSHLPPPPELHAAPQEHGADQGAVLDAGRSRAEMLAAIFAAQAGANVVPSDPTGHKRKL
DDDEYHDAPDSKRPASMAFGDGSGALPPPPPLGADAPVAMETIMCPPDKVGRVIGRAGAT
IRDLEASTGTRIQVDHKAPGDKPVTISGRADEVERAKRQVLDLISGHGSDAAPAPGEAQK
TLECPQGIVGRVIGRGGETIRTLQQASGAHILVNQDFPEGAARQITISGSQDAVDRAASM
VQELIGGEHANTSQVVQRFGVGSTEVLECPKTMVGRIIGKGGETIKDLQKRFNASIQIDQ
SAMPCKVTITGPSHTIASARRAIEDLIRSTGPPPGGMGMGGGSRPPYGAPYGQQYPGGAG
GYGGGYGGYGAPGGYGAPGGYPGYGGYGGYPGGAPYGGYNAGGYGAPGAQSSDPYGAGSS
SYNYGGAGGGSSSAAPGAPGSTPAAPGTNGSGSGGSSPWQALQDDQGRTYYYNSTTGVSQ
WERPADMP
Download sequence
Identical sequences Q6RBZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]