SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6S8Q5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6S8Q5
Domain Number 1 Region: 1-84,115-137
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-36
Family Duffy binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6S8Q5
Sequence length 137
Comment (tr|Q6S8Q5|Q6S8Q5_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:AAR32035.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=var OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
ARSFADIGDIIRGKDLYRGNNRENDKLEKKLKEYFKKIYEGLKGDAQNRYNGDGDNYYKL
REDWWDANRHTVWKAITCGADAGNKYFRVTCNDNGTLSQATKQCRCQKKDGANADQVPTY
FDYVPQYLRWFEEWAED
Download sequence
Identical sequences Q6S8Q5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]