SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6TA36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6TA36
Domain Number 1 Region: 23-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 
Weak hits

Sequence:  Q6TA36
Domain Number - Region: 86-111
Classification Level Classification E-value
Superfamily Orange domain-like 0.0235
Family Hairy Orange domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6TA36
Sequence length 155
Comment (tr|Q6TA36|Q6TA36_DANRE) Hairy-related 12 {ECO:0000313|Ensembl:ENSDARP00000044079} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=her12 OC=Cyprinidae; Danio.
Sequence
MAPHSATLASFDHLHFSDKEKIKLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSHDPSTK
LEKADILEMTVSFLKQQIKQQQQIPQRDFNEGYSHCWRESVHFLSLHSNAGELQHLHSGP
KTNSTMGSTPATACSKLNTAALQHPDSVRAVWRPW
Download sequence
Identical sequences Q6TA36
NP_991182.1.45394 ENSDARP00000044079 ENSDARP00000099379 7955.ENSDARP00000099379 ENSDARP00000044079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]