SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6V4H6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6V4H6
Domain Number 1 Region: 46-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.02e-34
Family PDI-like 0.00025
Further Details:      
 
Domain Number 2 Region: 387-495
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-29
Family PDI-like 0.00053
Further Details:      
 
Domain Number 3 Region: 256-388
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.63e-24
Family PDI-like 0.026
Further Details:      
 
Domain Number 4 Region: 161-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-16
Family PDI-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6V4H6
Sequence length 526
Comment (tr|Q6V4H6|Q6V4H6_XENLA) Protein disulfide-isomerase {ECO:0000256|RuleBase:RU361130} OX=8355 OS=Xenopus laevis (African clawed frog). GN=pdia2 OC=Xenopus.
Sequence
MRWLIFLQFCLLSTFYSSAFGQNDATEEPTKSSSEEETSDELLEEDNVLVLNKRNFNKAL
ETYKYLLVEFYAPWCGHCQELAPKYTKAAEILKDKTEEVRLAKVDGTVETDLSTEFNVNG
YPTLKFFKGGNRTGHIDYGGKRDQDGLVKWMLRRMGPAAVVLDNVESAEKFTSSQEFPVI
GFFKNPEDADIKIFYEVAELQEDFTFALAHDEKLFEKFGVTEDTVIFFKKSEENLNFKPD
EDLGLDKDELSKFLRINSIDLVTEYSAETSDKIFAAQIPNHLLLFINKSDDSQLVLLEHF
RKAAPDFKGKVLFVFIDSNGGYASVLEYFGLKSSDVPTLRFINLESVKKYVFNAPEITED
TIQAFCRSVLEGNVKQNLMSEEIPEDWDKSPVKVLVGKNFEEVAYDETKNVFVEFYAPWC
SHCKEMEPVWEELGEKYKDHENVIIAKIDATANEIDGLRVRGFPNLRFFPAGPERKMIEY
TKERTVELFSAFIDSGGVLPDEQETKEAEAEESKEAAEEDKGKDEL
Download sequence
Identical sequences Q6V4H6
gi|148222876|ref|NP_001083648| gi|38017209|gb|AAR07966| NP_001083648.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]