SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6VVF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6VVF7
Domain Number 1 Region: 43-258
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.26e-104
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000618
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.84e-16
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6VVF7
Sequence length 258
Comment (tr|Q6VVF7|Q6VVF7_9ARCH) Methyl-coenzyme M reductase subunit alpha {ECO:0000313|EMBL:AAQ63146.1} OX=115547 OS=uncultured archaeon. GN=mcrA OC=Archaea; environmental samples.
Sequence
AMQIGMSMINAYKMCAGESATGEFAYYAKHSAVVRLSNFMPVKRARSQNECSGMPLGINA
DSVRSNALFPNDPIRNELESIAVAAMVYDQLWFGTYMSGGVGFTQYASATYTDNILEDFC
YKGCEIGLDYAGGEMASLKGDKLNMDILEKIIRAENDYALTQYEAYPTVAESHFGGSVRA
CCAAAGCGSAVACATGLAQPTLSAWSLSQLGHYERVGRLGFYGYDLQDQCTACGSYSYQS
DEGMPFEMRGVNYPNYAM
Download sequence
Identical sequences Q6VVF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]