SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6Y1S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6Y1S1
Domain Number 1 Region: 159-294
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.06e-28
Family Toll/Interleukin receptor TIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 8-121
Classification Level Classification E-value
Superfamily DEATH domain 1.85e-25
Family DEATH domain, DD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6Y1S1
Sequence length 296
Comment (sp|Q6Y1S1|MYD88_RAT) Myeloid differentiation primary response protein MyD88 KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Myd88; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSAGGPRVGSVSVDSYLFSLPLVALNVGVRRRLSLFLNPRTTAAADWTSLAEEMGFEYLE
IREFETRPDPTRSLLDAWQGRSGSSVGRLLELLALLDREDILYELKDRIEEDCQKYIRNQ
QKQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPSDIEFVQEMIR
QLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP
Download sequence
Identical sequences Q6Y1S1
ENSRNOP00000018341 XP_006244149.1.100692 10116.ENSRNOP00000018341 ENSRNOP00000018341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]