SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6YVY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6YVY1
Domain Number 1 Region: 16-182
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.85e-26
Family G proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  Q6YVY1
Domain Number - Region: 180-321
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6YVY1
Sequence length 330
Comment (tr|Q6YVY1|Q6YVY1_ORYSJ) cDNA clone:J013146D08, full insert sequence {ECO:0000313|EMBL:BAG90888.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_07140 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MGGSEYDDDWELPSADITVVLCGKLGCGKSATGNSIVGREAFVSEYSHASVTSTCQLAST
ALKDGRTLNVIDTPGLFEMTITSEDAGKEIVKCMSMAKDGIHAVLMVFSATSRFTREDSS
TIETIKEFFGEKIVDHMILVFTYGDLVGENKLKSMLNNAPEYLQKTVELCKNRVVLFDNM
TKDRWLQEKQLENLLDVVDSVNTNNGGKPFSDQMLACIKEAHAREQEVHDAIGYTEEQIS
ELKKEIQRTRDEQLANITNMVEEKLNITVDKLQQQLMEEQNARLEAERLAAEARLRSDEE
IRKLKKRLEKAQQENEEFRKMASQHKCSIL
Download sequence
Identical sequences A0A0D9YTN7 A0A0E0NGE3 I1P1B0 Q6YVY1
XP_015627137.1.37577 XP_015627138.1.37577 39947.LOC_Os02g35130.2 LOC_Os02g35130.1|13102.m03810|protein LOC_Os02g35130.2|13102.m03811|protein OGLUM02G20870.1 LOC_Os02g35130.1|PACid:21920622 LOC_Os02g35130.2|PACid:21920623 ORGLA02G0176600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]