SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6Z4N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6Z4N3
Domain Number 1 Region: 86-202
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-24
Family Thioltransferase 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6Z4N3
Sequence length 279
Comment (sp|Q6Z4N3|TRL11_ORYSJ) Lilium-type thioredoxin 1-1 KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_25618, OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MAEALCSGSVASPCGEVGVGFAAGLVRGAAAAAALAESVPIGGYSSKSTFPSGRVALTER
KARPLPRNLEAAHGQMNLTIGKAMRWWEKCLQPNMREIESAQDLADSLLNAGDKLVVVDF
FSPGCGGCRALHPKIAQLAEKNPEVLFLQVNYEKHKSMCYSLHVHVLPFFRFYRGAQGRV
SSFSCTNATIKKFKDALAKHGPDRCGLGPAKGLEESELMALAINRDLNFTYTPNQDLVPI
ADALLKEAAAPGGPWLPLPATATQLFIQGSENSLLSSGR
Download sequence
Identical sequences A0A0E0I5T5 A2YQ16 Q6Z4N3
OsIBCD024632 ONIVA07G26370.1 XP_015646723.1.37577 39946.BGIOSIBCE026078 39947.LOC_Os07g48510.1 LOC_Os07g48510.1|PACid:21902045 LOC_Os07g48510.1|13107.m05197|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]