SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6Z9J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6Z9J1
Domain Number 1 Region: 230-398
Classification Level Classification E-value
Superfamily Bet v1-like 7.97e-29
Family STAR domain 0.024
Further Details:      
 
Weak hits

Sequence:  Q6Z9J1
Domain Number - Region: 50-156
Classification Level Classification E-value
Superfamily PH domain-like 0.0167
Family Pleckstrin-homology domain (PH domain) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6Z9J1
Sequence length 763
Comment (tr|Q6Z9J1|Q6Z9J1_ORYSJ) cDNA clone:J013102K12, full insert sequence {ECO:0000313|EMBL:BAG90347.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_080439100 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MATITLKPPATAAAAGGEVSEVELSEAGSPDVGSQSSGSGGSGRSTAGSSGWVYHLGVNS
IGHEYRHLRFLVIRGKTVAMYKRDPSKNPGIQPIRKGVVSHTLMVEELGRRITSHGELYV
LRFYNRLDQTKKGEIACGDPGEARKWVEAFEQAKQQADYDLMTRGVSWNRSQNENELNLD
GHRPRVRRYAQGLGKLVRIGKGPEKLLRQSSNLQSHEIINTNFGGDSGDAFEAHEWRYVR
TFNGIRIFEDIANTKGGKGVLLKSVGVVGANPDTVFAVVLSSDKHKRYEWDMLTADLELV
ETIDGYYDVVYGTYEPRYLSWWKTKKDFVFSRQWFRGQDGAYTILQIPACHKNKPPRHGY
ERTKINSSTWELRRLNPPGSSTPKCLVTHMLEMSPSFWDRWKRRHNENFDRSIAFALLSQ
VAGLREYFAANPALTSDLPSTVVKPKQSDSLIIQSELEDSELNDEFYDALARGESFEDED
SDDDDDMIPKAGKVKFKNISWAIAGLAMKPTKASVEKSELVTNSTPVTIDSNHFHGTLRR
AKSENDPNSWSEPGGEKFMIRGKTYLTDYTKVVGGDPLLKLIAVDWFKADERFDSVALHP
KSLVQSEAAKKIPFILVINLQVPAKPNYNLVMYYAAERPVNKDSLLGRFIDGTDAFRDAR
FKLIPSIVEGYWMVKRAVGTKACLLGKAVTCNYLRQDNFLEIDVDIGSSSVARSIIGLVL
GYVTGLVVDLAILIEAKEEKELPEYILGTVRLNRANPDSAVPI
Download sequence
Identical sequences Q6Z9J1
XP_015650076.1.37577 LOC_Os08g34060.1|PACid:21886775 LOC_Os08g34060.2|PACid:21886776 LOC_Os08g34060.1|13108.m03559|protein LOC_Os08g34060.2|13108.m03561|protein 39947.LOC_Os08g34060.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]