SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6ZEN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ZEN7
Domain Number 1 Region: 37-317,415-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.14e-67
Family FAD-linked reductases, N-terminal domain 0.00085
Further Details:      
 
Domain Number 2 Region: 298-405
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.97e-31
Family L-aminoacid/polyamine oxidase 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q6ZEN7
Sequence length 458
Comment (tr|Q6ZEN7|Q6ZEN7_SYNY3) Slr5093 protein {ECO:0000313|EMBL:BAD01863.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=slr5093 OC=Synechocystis.
Sequence
MIRRRSFFKLSQLMFVSYLLSTSCGKNNTPVTANDAPSILIIGAGLAGLAAAQSLMKQGY
TVRVLEARDRLGGRTWTSNYWDDAPLDMGASWIQGTEGNPITELAEKIATPLVMTSYDNA
ITYEVGGQPFTAKEDRIIEQLEKKWQGAIATAQNGDGDQSLQAVIENVFDLENQPLETKQ
IIDWYMNSTIEHEYAGSLKDTSIYWFDGDGGFGGDDAIFVEGYQAIVNYLAKDISIELNQ
IVESIDYSEEIPKIITNQGAYTADQVIITLPLGVLKSGQVKFIPELPSPKRKAIKALGMG
ILNKCYLRFPKVFWPKKVDWIEQVPTERGLWSEWVNIFRVNQLPILLGFNAADEGKEIET
WTDEEIIKSAMKTLRHLFGDDIPDPTDYQITRWQSDSFSRGSYSFNALGSHPDMRDHLAK
SLNDQIFFAGEATERDYFATAHGAYLSGLRVAEEINNL
Download sequence
Identical sequences Q6ZEN7
gi|38505628|ref|NP_942249.1| gi|38505628|ref|NP_942249.1| 1148.slr5093 WP_011153630.1.1889 WP_011153630.1.35395 gi|38505628|ref|NP_942249.1|NC_005229 gi|451816636|ref|YP_007459839.1|NC_020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]