SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6ZNG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6ZNG9
Domain Number 1 Region: 273-418
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.64e-17
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 36-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000085
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 
Weak hits

Sequence:  Q6ZNG9
Domain Number - Region: 123-240
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0994
Family FCH domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6ZNG9
Sequence length 492
Comment (sp|Q6ZNG9|KRBA2_HUMAN) KRAB-A domain-containing protein 2 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=KRBA2; OC=Catarrhini; Hominidae; Homo.
Sequence
MPSFLVPSLVSSPVLLKLLFSPGPKTIWSLWQQPMLFQEATAFENMTKDWNYLEGSQKDC
YRDTMLDSYENTVPQGSFLQLSMMPQRAGNDPPGVSNASEMEMEISNMREKFLMSVTKLV
ESKSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEKLIEATHGE
RDRIRYYVHKEELFDILHDTHLSIGHGGRTRMLKELQGKYGNVTKEVIVLYLTLCKQCHQ
KNPVPKRGLAPKPMTFKDIDSTCQVEILDMQSSADGEFKFILYYQDHSTKFIILRPLRTK
QAHEVVSVLLDIFTILGTPSVLDSDSGVEFTNQVVHELNELWPDLKIVSGKYHPGQSQGS
LEGASRDVKNMISTWMQSNHSCHWAKGLRFMQMVRNQAFDVSLQQSPFEAMFGYKAKFGL
YSSNLPRETVATLQTEEELEIAEEQLENSLWIRQEERAEIGADRSDMDDDMDPTPEASEP
STSQGTSGLLCW
Download sequence
Identical sequences Q6ZNG9
ENSP00000328017 9606.ENSP00000328017 ENSP00000328017 gi|47106061|ref|NP_998762.1| ENSP00000379565 NP_998762.1.87134 NP_998762.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]