SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6ZUS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q6ZUS5
Domain Number - Region: 43-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6ZUS5
Sequence length 278
Comment (sp|Q6ZUS5|CC121_HUMAN) Coiled-coil domain-containing protein 121 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CCDC121; OC=Catarrhini; Hominidae; Homo.
Sequence
MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNS
YLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKE
IQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQAL
KLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESL
IQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
Download sequence
Identical sequences Q6ZUS5
ENSP00000339087 NP_078860.2.87134 NP_078860.2.92137 ENSP00000339087 gi|39979626|ref|NP_078860.2| GO.55802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]