SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q71RA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q71RA6
Domain Number 1 Region: 132-162,197-254
Classification Level Classification E-value
Superfamily SH3-domain 1.03e-16
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 2 Region: 76-139
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.6e-16
Family BAR domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q71RA6
Sequence length 255
Comment (tr|Q71RA6|Q71RA6_HUMAN) PP9455 {ECO:0000313|EMBL:AAQ15269.1} OX=9606 OS=Homo sapiens (Human). GN= OC=Catarrhini; Hominidae; Homo.
Sequence
MGDGGRVCHCSCLWGPEWGSSFSGVGAPGVKSGIDPEGSLCSQGKGTGGSQVGSRRRLRG
SWWVVCGCSWLPCPAQAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQ
TTYYAQCYRHMLDLQKQLGRFPGTFVGTTEPASPPLSSTSPTTAAATMPVVPSVASLAPP
GEASLCLEEVAPPASGTRKARVLYDYEAADSSELALLADELITVYSLPGMDPDWLIGERG
NKKGKVPVTYLELLS
Download sequence
Identical sequences Q71RA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]