SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q72HI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q72HI8
Domain Number - Region: 145-252
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00301
Family Laminin G-like module 0.044
Further Details:      
 
Domain Number - Region: 33-91
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0968
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q72HI8
Sequence length 444
Comment (tr|Q72HI8|Q72HI8_THET2) Uncharacterized protein {ECO:0000313|EMBL:AAS81841.1} KW=Complete proteome OX=262724 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039). GN=TT_C1499 OC=Thermus.
Sequence
MRKGLWLLAAGALLGACAPRITAEPLPGVRVDVPVQVPPPASPPQPSQPAGQAQGGVTAP
VIKVLPGNPLPPAGSAYVDDFSSYPTGAVLPVVAPERYGLLRTGGDWQKITVEEAFAPDG
RLDKAVRMEGGYGEGFLTTGAEDWTDYRVSFRLKTLEACCTHSHIRARLFLNGAGSRALE
FFIGRDPINGVGLYKLAGDQRFLLLQRRELNPTANAVLRDGNWHDFVFELRGDGTVRVFV
DRTEVVNWKDPDYHRGGFGIGPVGVTFQLDDLKVERLGGATPPLPGPPTGEAPPRRENFC
GYRAGAELPHERFLADGQVELRLLGGHSAARNYRIGYYPAGKPEAPSYALSYQGNFEPPT
CLNPPLVAIFRPQGSFGLAHNYEHYGNKTVYTEDRFNETPRGFRAYEAINSRGEKEGILL
LVEDWIDGDFDDVGLLLIGAKPEG
Download sequence
Identical sequences Q72HI8
WP_011173874.1.85415 262724.TTC1499 gi|46199801|ref|YP_005468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]