SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q737C8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q737C8
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000000512
Family Epoxide hydrolase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q737C8
Sequence length 97
Comment (tr|Q737C8|Q737C8_BACC1) Hydrolase, alpha/beta fold family {ECO:0000313|EMBL:AAS41634.1} KW=Complete proteome OX=222523 OS=Bacillus cereus (strain ATCC 10987 / NRS 248). GN=BCE_2722 OC=Bacillus cereus group.
Sequence
MWKTNIVKTTRGNFEYFVKGEGPPLCVTHMYSEYNDNGNTFANPFTDHYSVYLVNLKGCG
NSDSAKNDSEYSMTETIKDLEAIREALYINKWGFAGH
Download sequence
Identical sequences Q737C8
222523.BCE_2722 gi|42781779|ref|NP_979026.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]