SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74KB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74KB1
Domain Number 1 Region: 339-490
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.04e-27
Family HD domain 0.024
Further Details:      
 
Domain Number 2 Region: 228-323
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q74KB1
Sequence length 540
Comment (sp|Q74KB1|RNY_LACJO) Ribonuclease Y {ECO:0000255|HAMAP-Rule:MF_00335} KW=Complete proteome; Reference proteome OX=257314 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533). GN=rny OC=Lactobacillus.
Sequence
MVNTILVPVAVAIVSVLVGGCAGYSIRKNKWETQAQNAAHDAKHILADAESKAKAVEADL
ASQKEAMKKAAADAKKEKILEAQEEIHHYRERVDNELNERRQEVSRQENRLLQREDAIDH
KDSLLDQKDSQLTQKENQIKKLQAQVLEKENRADQLVTEREKKLYEVAELNQEDAKKIVL
DKLSDQLVKERAEMIEESNQLAKAKADHFARKVIVDAIQSSAADTVSEKTVSVVNLPSDD
MKGRIIGREGRNIRSFEALTGVDVIIDDTPDVVVLSGFDPIRREIAKRALERLIKDGRIH
PARIEEMVDRARKEVNDDIYEAGESALMELGIHKMHPELVKILGRLKYRTSYGQNVLSHS
IEVGKLTGVMAAELGLDEKIAVRAGLLHDIGKSIDHEIEGSHVEIGVELARKYHEPDLVV
NAIAAHHDDVPKLSFIAELVVAADTISSARPGARSESLENYIRRLEQLETIAKGHIGVKQ
AYAIQAGREIRVMVEPDKISDARTTILAHDIRNQIEQDMEYPGNIKVTVIREKRAVAIAK
Download sequence
Identical sequences A0A1B3PTC5 F4AG92 F7SEQ5 Q74KB1 V5P453
257314.LJ0840 gi|385826243|ref|YP_005862585.1| LjR32 gi|42518765|ref|NP_964695.1| gi|560152532|ref|YP_008845387.1| WP_004897729.1.13362 WP_004897729.1.24787 WP_004897729.1.27409 WP_004897729.1.46682 WP_004897729.1.54950 WP_004897729.1.65350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]