SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74M88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74M88
Domain Number 1 Region: 4-136
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.02e-29
Family Translational machinery components 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q74M88
Sequence length 136
Comment (tr|Q74M88|Q74M88_NANEQ) 30S ribosomal protein S9 {ECO:0000256|RuleBase:RU003817} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ446 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence
MKHLVVSAKRKTSIARAYFREGNGIIRINGFLLEVWQNPLARARVKEPLIIAENIIPGIT
KEIDINVNVFGGGWHSQTEAVRQAIARGLVVWTGSDQLKKAFLEYDNWLLVNDPRRKEQN
KSLRSKPRAWRQTSYR
Download sequence
Identical sequences Q74M88
gi|41615231|ref|NP_963729.1| 228908.NEQ446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]