SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74MD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74MD6
Domain Number 1 Region: 7-116
Classification Level Classification E-value
Superfamily Prefoldin 1.15e-18
Family Prefoldin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q74MD6
Sequence length 121
Comment (tr|Q74MD6|Q74MD6_NANEQ) NEQ385 {ECO:0000313|EMBL:AAR39234.1} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ385 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence
MDLREKYLLFEELTKEYEVILNRVAELELAIEYLKELRDGNGLILFNGLLIKGEAKETNK
VIVPVGAKYYVEIDKDKAIEKMAKQLDSLKIEAEKLKNDIDKIKDELKEELAKLQQNNIA
V
Download sequence
Identical sequences Q74MD6
gi|41615175|ref|NP_963673.1| 228908.NEQ385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]