SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74ME1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74ME1
Domain Number 1 Region: 131-442
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.59e-103
Family Leucine aminopeptidase, C-terminal domain 0.00000194
Further Details:      
 
Weak hits

Sequence:  Q74ME1
Domain Number - Region: 57-132
Classification Level Classification E-value
Superfamily Macro domain-like 0.000112
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q74ME1
Sequence length 443
Comment (tr|Q74ME1|Q74ME1_NANEQ) NEQ412 {ECO:0000313|EMBL:AAR39257.1} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ412 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence
MPTKFYLTDHADGGVIVKFFKDRESVKSYANVDEDFFKRDNAIFVKKDRDYLIVYVKDEW
KAYFLAGRYIKNSPFKEFIIDLREIESKDKAIIGILSTSYIFDRYKSEKQEKIIKFICDD
KEKVKEYITLMEAQYLARDLANEPPNVLNPETYEKKIIEIFKGLPVNIKVLHYDDLIREG
LNLLVYVGKGSIYKPRLVILEYNLKDNPIVLVGKAITFDTGGYSLKPTDYMYNMHGDMSG
SAAVIGALYAIAKNKKDIPIVALIPIAENVISGESYKVNDIIKAYNGKTVEVTNTDAEGR
LTLADAIAYSAKYNPKAIIEVSTLTGGQIIALGHEIAAAMGEKDLVNKAIEAGKEVYELV
WELPLYEGYRELLKSAVADIKNANGREAHAIQGGLFLKEFSPIEKFLHLDIAGPAIANRA
IPSAYKGLTGFGVRLLYKLVQKL
Download sequence
Identical sequences Q74ME1
228908.NEQ412 gi|41615198|ref|NP_963696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]