SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q74MW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q74MW2
Domain Number 1 Region: 61-262
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-29
Family Clostridium neurotoxins, the second last domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q74MW2
Sequence length 356
Comment (tr|Q74MW2|Q74MW2_NANEQ) NEQ500 {ECO:0000313|EMBL:AAR39341.1} KW=Complete proteome; Reference proteome OX=228908 OS=Nanoarchaeum equitans (strain Kin4-M). GN=NEQ500 OC=Archaea; Nanoarchaeota; Nanoarchaeales; Nanoarchaeaceae; Nanoarchaeum.
Sequence
MRSITPIIAIVILLLVTISAVTPLYLWVQKGVQKYSQKATKTADTTFKSITNLEIADIKI
YKKYDGALALWYLDEGFGNIVDDYSNNNYKLKFEGSPRWVKGVLSNALEFNGNSSLKGNY
QLLVGKTKWSITLITKPYSLANYTYAEGTTDGDKIVLEIANNKFRIAISNNSVGWQRLSS
SLPLSKNEWYFVAVTYDGDNLKICVNNVCNSTSGIKSATTGGGTVKIANGVYANYPYKGV
IDEIYLYNEPLDNKTIENLYYRLTVRVVNPNDRPIKIEGYYQIEDPETGNIICEIPLKYK
ETFITDSGSDLIKPSKEETIRMVLFYKDKHCSLNKWKTYNFCLTNGINRVCKLFHP
Download sequence
Identical sequences Q74MW2
228908.NEQ500 gi|41615282|ref|NP_963780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]