SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q75E43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q75E43
Domain Number 1 Region: 212-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q75E43
Sequence length 302
Comment (tr|Q75E43|Q75E43_ASHGO) ABL173Cp {ECO:0000313|EMBL:AAS50598.1} KW=Complete proteome; Reference proteome OX=284811 OS=Y-1056) (Yeast) (Eremothecium gossypii). GN=AGOS_ABL173C OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium.
Sequence
MTNKRRAPLEDISNAIIGQVLETKDARIGRGNGEDFSVDRPQVTAAALDGLFLDGRQLRI
GGGQARSIGGWVRLRVARWSLRKALNTGHVLAAERGQAALIARAHDSQTVELSGRSLDCT
TLSLLRVVGQVAVTVTPALLTQLRCRQLKLRSAIRAWQDTVLLPTHDSEALLADLRIIVS
SGVYPASGPMLIHSCPPLPTPVAPLHAALALPTITQELELNKPQVSFLIGENGSRIEYIK
VASSAIVKVLPIKNKLQNSELKNPSCVRQSLAITGDLCAVARALTSIQAFLDLYHANAKH
KF
Download sequence
Identical sequences Q75E43
tr|Q75E43|Q75E43_ASHGO NP_982774.1.49492 33169.AGOS_ABL173C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]