SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q75H96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q75H96
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-16
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Weak hits

Sequence:  Q75H96
Domain Number - Region: 261-305
Classification Level Classification E-value
Superfamily BAS1536-like 0.0471
Family BAS1536-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q75H96
Sequence length 500
Comment (tr|Q75H96|Q75H96_ORYSJ) Putative PH domain containing protein {ECO:0000313|EMBL:AAR87174.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OsJ_12012 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWVILDPTSGK
MEYKIRRNETAIKGTIIFDASSTITLSPVNFQGMPKYDGCCFYIGTPQKKDYFLCAETPG
AAKAWVSTLLATQLVLQAHKEAVNSLAGNGSPATLGTVATAVANANATALEATKEIEAAM
KVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQNLAKDIRARDATIKEIANKLTE
TAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQMEQSMLKLRQSEEKVISLSKEKDQ
LLKERDAALQEAHMWRTELGKAREQAVIQEATIARADEKVRASEADAAARIKEAAEKLHA
VEKEKEELLSLVGILQSQVQREQSSTKQVCEERSESCSGTDNSPPLTKHVDASDDDVDKA
CVSDSRSVLVSNDNTEVQLAVDGVDIRPIGDAEWGSFQQSEALIADVREVSPESEGGSLD
IPVVNPPPVSDHIQGGATHP
Download sequence
Identical sequences B8ANN2 Q75H96
XP_015630802.1.37577 LOC_Os03g46340.1|13103.m04986|protein LOC_Os03g46340.1|PACid:21914493 39947.LOC_Os03g46340.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]