SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q78QS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q78QS6
Domain Number 1 Region: 6-89
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000304
Family Ribonuclease H 0.0067
Further Details:      
 
Weak hits

Sequence:  Q78QS6
Domain Number - Region: 161-194
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0345
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q78QS6
Sequence length 196
Comment (tr|Q78QS6|Q78QS6_MOUSE) Tumor necrosis factor receptor superfamily member 22 {ECO:0000313|Ensembl:ENSMUSP00000126384} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_147563 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVLQFVCKKKWPDVRLFTDSWAVANGLAGWSGTWKDHNWKIGEKDIWGRSMWIDLSKWAK
DVKIFVSHVNAHQKVTSAEEEFNNQVDTMTPSVDSQPLSPAIPVIAQWAHEQSGHGGRDG
GYAWAQQHGLPLTKSDLATAAADCQICQQPKPTLSPRYGIIPRGDQPATWWQVDYIGPLP
SWKGQRFVLTGVDTLG
Download sequence
Identical sequences Q78QS6
ENSMUSP00000126384 ENSMUSP00000126384 ENSMUSP00000126384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]