SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7G188 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7G188
Domain Number 1 Region: 125-621
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-166
Family Calponin-homology domain, CH-domain 0.00000000000000616
Further Details:      
 
Domain Number 2 Region: 14-98
Classification Level Classification E-value
Superfamily EF-hand 0.000000595
Family Polcalcin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7G188
Sequence length 687
Comment (sp|Q7G188|FIMB1_ARATH) Fimbrin1 {ECO:0000305} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F10M23.40 OC=Arabidopsis.
Sequence
MSGYVGVVVSDPWLQSQFTQVELRTLNSKYVSVKNQNGKVTIEDLPPLFAKLKALSATFK
EDEIKGMLGELGSDTSTDVSFEEFLKIYLNLLSKAAEKSGGHHKNSSSFLKACTTTLLHT
IYQSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDGVLLCKLINVAVPGTIDE
RAINTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAEGRPHLVLGLISQLIKIQV
LADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFHLKKGGYKKTVSNFSADLKD
AQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERMNCKRYLTAEEIVEGSSTLNL
AFVAQIFHERNGLNKDGKYAFAEMMTEDVETCRDERCYRLWINSLGIDSYVNNVFEDVRN
GWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQVIKIGKQLKFSLVNVAGNDIVQ
GNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDADILSWANRKVRTMGRKLQIESFK
DKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEKRLNATYIVSVARKLGCSVFLLPED
IVEVNQKMILILTASIMYWSLQRHSRESSDSSSTQSTTTTCTSTASSPAPSVTEEEEVSS
LSGEVTSLAVGDAVSEITTVSEEASIE
Download sequence
Identical sequences Q7G188
AT4G26700.1 NP_001031726.1.80155 NP_001328753.1.80155 NP_194400.1.80155 3702.AT4G26700.1-P AT4G26700.1 AT4G26700.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]