SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7JXU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7JXU8
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily L domain-like 3.4e-37
Family Internalin LRR domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q7JXU8
Sequence length 378
Comment (tr|Q7JXU8|Q7JXU8_DROME) RH62264p {ECO:0000313|EMBL:AAL90423.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG11099 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNKTILHWSYLNFKDVPMDLFLYEDLEEVYLKENFISVIPKWLLNITTLKFIHLAGNNLS
ELPVDIYMLENLEFLDVSNNELKELPPTLGLLLNLQQLNVSGNQLTELPVELSGLRNLEH
LNIGKNQFRRLPVQLSECVRLNELNVSDNEALVHIPERISNLPMLQSLAADRCALVYLPA
ALSKFMNHVRIFHNTAINYIPMVYERFYQNFYDNRQRNTPVAVHRKGLFWVRELETSTRL
LLPVGTRTVFPVPSVENRVSLYDDCLHALQTLNRFTPVYENVAMHRLLPEPYISSHINNG
PIARCTNSTCSRCLYTSYYFMVVKRRGSTSKQLFTCNFCTNRCGLLWLTSNDKKYYQLAW
RVSDDDDDDEEEHMASNK
Download sequence
Identical sequences Q7JXU8
FBpp0085624 NP_001286627.1.81976 NP_611457.1.81976 FBpp0085624 FBpp0085624 7227.FBpp0085624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]