SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7K173 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7K173
Domain Number 1 Region: 338-631
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.11e-85
Family beta-glycanases 0.0000000908
Further Details:      
 
Domain Number 2 Region: 33-222
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.46e-55
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00000545
Further Details:      
 
Domain Number 3 Region: 224-335
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.24e-19
Family beta-Galactosidase/glucuronidase domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7K173
Sequence length 656
Comment (tr|Q7K173|Q7K173_DROME) Beta-glucuronidase {ECO:0000256|RuleBase:RU361154} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG15117 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MALSIFSLVTGLYVLHFSIALILVNKEVPQTRGMLYPRESETREVRSLDGIWNFVRSDQA
NPTQGVRDEWYAKELSKSRPTIPMPVPASYNDITTDNLRDHVGTVWYDRKFFVPRSWSKD
QRIWLRFGSVHYEAYVWINGQKVVKHEMGHLPFEAEVTDLLSYGAENRITVMCDNALIQT
TVPQGRITEVPNDGGMTIVQSYTFDFFNYAGIHRSVHLYTTPRTFIEEVEVTTNLSKDAT
VGEVFYSVSVNGSAANEADNVLQIQANLYDKDGILVANATSDQKLGGKLQVNPVKPWWPY
LMHSEPGYLYQLEIKLLATNDELLDVYRLKVGIRTLSWNSQQFLINGKPVYFRGFGRHED
SDIRGKGLDNALMVRDFNLLKWIGANAYRTSHYPYSEESMQFADEHGIMIIDECPSVDTE
NFSQELLGKHKSSLEQLIHRDRNHPSVVMWSIANEPRTGSVSADSYFELVANFTRSLDKT
RPITAAIAVSNTQDKAGRSLDIISFNRYNAWYSNAGRLDMITQNVIDEAIAWNKRYNKPI
IMSEYGADTLEGLHMQPAYVWSEEFQTEVFSRHFKAFDELRKKGWFIGEFVWNFADFKTA
QSYTRVGGNKKGVFTRARQPKAAAHLLRKRYFALGRDLDQCSFPEDLFTYIADLIS
Download sequence
Identical sequences Q7K173
FBpp0085777 NP_611395.1.81976 FBpp0085777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]