SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7KTX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7KTX2
Domain Number 1 Region: 754-950
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-64
Family Sec7 domain 0.00000533
Further Details:      
 
Domain Number 2 Region: 951-1085
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q7KTX2
Sequence length 1313
Comment (tr|Q7KTX2|Q7KTX2_DROME) Schizo, isoform A {ECO:0000313|EMBL:AAS65082.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32434 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRCDNHKSRRQQLPVPAPLSSSHSNSSSSRSQGHHHHHHHQLHSSNSDLGGSESFLQYC
SDSEKRPPPIVVVVGDGRSRVRRVVRTATRHVTVVSLSTRHKETQTHTSHHVTAVSFPQK
SLERSGSTQYELAGAQQPGSANASTCTDSGSVGGYVYLQNHYAPGAHSSSAAINYPAQQH
PQMVYQIQQYPTCHQQQQQQHLQQQQHLHQTGAGHYMQVTATGGGQYHHHHMLHGHGHHA
HHHGGAVVIAGSGVGTGLGSGATSVIMQHQQQQQQQQNMHKKNSIRNGGDVLKRTRAQSA
YELSQDLLEKQIELLERKYGGVRARNAAVTIQRAFRHYMMVKKFASITAMAKAEKRLSRR
MVVTASSLGLAEEGASSSSAYGSATESQLTEQQQQQQAQQQQQPRVTIMAGPAGAASPGL
SRTPPTRSLSMRERRQLDCSPIPRSQSGASPASISSSTVSTSALASHPHVNLLHAAEPHY
YNAQALPQGAAYYTSYHGSPHDLSYASSADTSLNASWVNTSGHSPHTPYYSAAQIYMRPK
GGSTTPTPSCSGSTGSGSGGSGSGSSKKVPPEVPKRTSSITAQQQTQLLLLQRQTPPPPS
LLRTNGLCKTAENGSLTSVQSSGSDSSVTSAERNLNSDLGSDRSNSPHTWKRGTALNSSQ
QFSTHSADSAGAVSGGGVGVAGGAGVYAAQMQAAVAAATAAGGMPPADDHAISSHTSAAQ
YEQHEQQQHEQQQLQAAAAAAGVAQNYKMSETIRKRQYRVGLNLFNKKPEKGITYLIRRG
FLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRK
FQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPN
LKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDHVTQVMKVQATIV
GKKPNLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTY
TFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRCKFAEDLKESISE
MDEMESLRIEAELERQKSARNRAPGNAENRDSGVADVEVCPCPYQQGSQASGEQAPNSAD
NSQQLKRSALSNSLLDMHEQFGNEKPQRRGSVGSLDSGMSISFQSTTTSSASRENAAAIA
AAANAAAAAKMRFNMPPTAAIATPSNVYAAPGMQAYTHANFVQQSQAAYMLQQQQMLQQQ
AQMQAQAQAQAQAQAQAQAQAQAQAQAQPLTGRIPGRERKASRTDENGRSTEV
Download sequence
Identical sequences Q7KTX2
FBpp0077948 NP_996129.1.81976 FBpp0077948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]