SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q7KVP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q7KVP5
Domain Number 1 Region: 101-483
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-92
Family Ankyrin repeat 0.000011
Further Details:      
 
Domain Number 2 Region: 1242-1316
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000024
Family SAM (sterile alpha motif) domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q7KVP5
Sequence length 1552
Comment (tr|Q7KVP5|Q7KVP5_DROME) Uncharacterized protein, isoform M {ECO:0000313|EMBL:AAM70867.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG42672 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRRTPKLQLVGRAYSEMSPLNPDSLTDSPTTSSAGQDRRADQSGYGSIFPFGLLRGSFGR
GGNASQNINRFGDSMGSLGHRALLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVV
AGRGLTAFVREFLARGADVQAEDLDNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGW
TSLMWAAYRGHTELVRLLLDKGADGNAHGNYHLGALLWAAGRGYKDIVELLVQRGAKVNV
GDKYGTTALVWACRRGNVEIVDTLLKAGANVDTAGMYSWTPLLVAAAGGHTDCVSSILEK
KPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINIQDRGADTPLIHAVKAGHRTVV
EALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLLLATNPDLESATKDGDTPLLRAVRN
RNLEIVHLLLDRKAKVTASDKRGDTCLHIAMRARSKTIVEALLRNPKHSQLLYRANKAGE
TPYNIDSLHQKTILGQVFGARRLNTNEDSEGMLGYELYSSALADVLSEPTLTTPITVGLY
AKWGSGKSFLLNKLRDEMNNFARQWAEPPIRTSGLLFIVCLHVALLIGTIVGLSTWSAVV
GVSAAVGFLLLAYLLLAAVRYCNYQMDMQWAYSVQHGLEKRMTRLRLILQVAFCHPPGPQ
SDSQAKPVRFHFAEANSASPTGDGAVAHMLAALLDAIESHYGWLATRLYRAFRPKCLKVD
VGWRWRRMCCIPIVLIFELALVTVVTGISLTVAYFTFADEKEKEHILVALYVIAAVMGTL
ICTHLHVLAKVFVSLFTSHIRVLKRAVRSSESAPLTMLGAEVAVMTDMVKCLDAFTNQQS
RLVGVIDALDSCDTERILTLLNAVQTLLSSPNRPFVLLISVDPHVIAKAAEANSRRLFTE
GGIGGHDFLRNLVHLPVYLQNSGLRKVQRAQMTALLFKRSGGGDYQTDDGPTLGHSVSAR
RLSNASEIISSQEKLRGPARGGGGKKLRLSESVASSTGSNLHRLGQNPQTVLDLSRIVLT
DDYFSDVNPRSMRRLMNVIYITVRLLKAFQIEFSWYRLSSWINLTEQWPLRASMIVLHHD
QFMDSNADESVSLQSVYEKLRPKLAYLREAAPLLELDRDERKLDAFLQLHKSDLLVADLR
IFLPFTINLDPYLRKVLKEDQQTIEDEGSLVIQARPSVSNTMRQFPAPTTYVPSPQAYPP
YQMFQNEYPANELRSRNLSTSTEPVTPLINSPSDSFGDDILQTKLTDLTVEGVISLLDRI
EDMKPALPKLAPVLRENAINGRVLKHCDMPDLKSVLGLSFGHWELFRLLITTLRECERLP
RKQQRQQQQPGALEAPSNVPMIKDVTDALMQPPRESLSRKNSVSHMEKQVTLEEQMICGT
LQTLNEEAYEDVASSERPSPTELDTPSAGAAMTTPLLGASGSVPAPSGRESILKQQGSVK
ADKRVSIQQMATSNNNNNNSTKLTPNVEYVSERQPEVQGAGKRLTTKPPPGPRPASLIIT
RNDSNSQFQLLRSSSVDYDDVEAQEHRTTIRTTLLEQQEEEESAPFVFTVRK
Download sequence
Identical sequences Q7KVP5
NP_726060.3.81976 FBpp0291847 FBpp0291847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]